SPG21_MOUSE Q9CQC8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9CQC8
Recommended name：Maspardin
EC number：
Alternative names：(Acid cluster protein 33) (Spastic paraplegia 21 autosomal recessive Mast syndrome protein homolog)
Cleaved into：
GeneID：27965
Gene names (primary )：Spg21
Gene names (synonym )：
Gene names (ORF )：
Length：308
Mass：34952
Sequence：MGEIKVSPDYNWFRSTVPLKKIIVDDDDSKIWSLYDAGPRSIRCPLIFLPPVSGTADVFFQQILALTGWGYRVIALQYPVYWDHLEFCDGFRKLLDHLQLDKVHLFGASLGGFLAQKFAEYTHKSPRVHSLILCNAFSDTSIFNQTWTANSFWLMPAFMLKKIVLGNFSSGPVDPMMADAIDFMVDRLESLGQSELASRLTLNCQNSYVEPHKIRDIPVTIMDVFDQSALSTEAKEEMYKLYPNARRAHLKTGGNFPYLCRSAEVNLYVQIHLLQFHGTKYAAIDPSVVSAEELEVQKGRLGLSQEEP
Tissue specificity：Expressed in cell lines FT.1 and in a L cell fibroblast derivative (at protein level). {ECO:0000269|PubMed:11113139}.
Induction：
Developmental stage：
Protein families：AB hydrolase superfamily