LICH_MOUSE Q9Z0M5
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9Z0M5
Recommended name：Lysosomal acid lipase/cholesteryl ester hydrolase
EC number：EC 3.1.1.13
Alternative names：(Acid cholesteryl ester hydrolase) (LAL) (Cholesteryl esterase) (Lipase A) (Sterol esterase)
Cleaved into：
GeneID：16889
Gene names (primary )：Lipa
Gene names (synonym )：Lip1
Gene names (ORF )：
Length：397
Mass：45325
Sequence：MQLQGLVFVFTIGILLSRVPTGTVSAVDPEVNMNVTEIIMRWGYPGEEHSVLTGDGYILSIHRIPRGRKNHFGKGPRPVVYLQHGLLADSSNWVTNIDNSSLGFLLADAGFDVWMGNSRGNTWSLKHKTLSVSQDEFWAFSFDEMAKYDLPASINYILNKTGQEQIYYVGHSQGCTIGFIAFSQMPELAKKIKMFLVLAPVLSLNFASGPLLQLGRLPDPLLKDMFGQKQFLPQSAMLKWLSIHVCTHVIMKELCANVFFLLCGFNEKNLNMSRVDVYTTHCPAGTSVQNMLHWGQVFKYRKLQAFDWGSSEKNYFHYNQSFPPSYNIKNMRLPTALWSGGRDWLADINDITILLTQIPKLVYHKNIPEWDHLDFIWGLDAPWKLYDEIISLMKKYQ
Tissue specificity：Expressed at low levels in most tissues. High level expression is found in hepatocytes and splenic and thymic cells. Very high level expression is observed in cells of the small intestinal villi, the zona fasciculata and reticularis of the adrenal cortex, pancreatic acini, and renal tubular epithelium. {ECO:0000269|PubMed:8725147}.
Induction：
Developmental stage：
Protein families：AB hydrolase superfamily, Lipase family