K1KB3_MOUSE P00756
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P00756
Recommended name：Kallikrein 1-related peptidase b3
EC number：EC 3.4.21.35
Alternative names：(7S nerve growth factor gamma chain) (Gamma-NGF) (Glandular kallikrein K3) (mGK-3) (Tissue kallikrein-3)
Cleaved into：Nerve growth factor gamma chain 1; Nerve growth factor gamma chain 2
GeneID：18050
Gene names (primary )：Klk1b3
Gene names (synonym )：Klk-3 Klk3 Ngfg
Gene names (ORF )：
Length：261
Mass：28998
Sequence：MWFLILFLALSLGGIDAAPPVQSRIVGGFKCEKNSQPWHVAVYRYTQYLCGGVLLDPNWVLTAAHCYDDNYKVWLGKNNLFKDEPSAQHRFVSKAIPHPGFNMSLMRKHIRFLEYDYSNDLMLLRLSKPADITDTVKPITLPTEEPKLGSTCLASGWGSITPTKFQFTDDLYCVNLKLLPNEDCAKAHIEKVTDAMLCAGEMDGGKDTCKGDSGGPLICDGVLQGITSWGHTPCGEPDMPGVYTKLNKFTSWIKDTMAKNP
Tissue specificity：
Induction：
Developmental stage：
Protein families：Peptidase S1 family, Kallikrein subfamily