K1KB4_MOUSE P00757
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P00757
Recommended name：Kallikrein 1-related peptidase-like b4
EC number：
Alternative names：(7S nerve growth factor alpha chain) (Alpha-NGF)
Cleaved into：
GeneID：18048
Gene names (primary )：Klk1b4
Gene names (synonym )：Klk-4 Klk4 Ngfa
Gene names (ORF )：
Length：256
Mass：28548
Sequence：MWFLILFLALSLGGIDAAPPVQSQVDCENSQPWHVAVYRFNKYQCGGVLLDRNWVLTAAHCYNDKYQVWLGKNNFLEDEPSDQHRLVSKAIPHPDFNMSLLNEHTPQPEDDYSNDLMLLRLSKPADITDVVKPITLPTEEPKLGSTCLASGWGSTTPIKFKYPDDLQCVNLKLLPNEDCDKAHEMKVTDAMLCAGEMDGGSYTCEHDSGGPLICDGILQGITSWGPEPCGEPTEPSVYTKLIKFSSWIRETMANNP
Tissue specificity：
Induction：
Developmental stage：
Protein families：Peptidase S1 family, Kallikrein subfamily