CXL17_MOUSE Q5UW37
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q5UW37
Recommended name：C-X-C motif chemokine 17
EC number：
Alternative names：(6-Cys CXCL17) (13.6 kDa protein) (VEGF coregulated chemokine 1)
Cleaved into：4-Cys CXCL17
GeneID：232983
Gene names (primary )：Cxcl17
Gene names (synonym )：Vcc1
Gene names (ORF )：
Length：119
Mass：13627
Sequence：MKLLASPFLLLLPVMLMSMVFSSPNPGVARSHGDQHLAPRRWLLEGGQECECKDWFLQAPKRKATAVLGPPRKQCPCDHVKGREKKNRHQKHHRKSQRPSRACQQFLKRCHLASFALPL
Tissue specificity：Detected in lung, trachea, lung, tongue thyroid, submaxillary gland, epididymis, and uterus tissues and at a lower level in ovary, prostate and in intestinal tissues. {ECO:0000269|PubMed:16989774, ECO:0000269|PubMed:24973458}.
Induction：
Developmental stage：
Protein families：Intercrine alpha (chemokine CxC) family