CC21A_MOUSE P84444
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P84444
Recommended name：C-C motif chemokine 21a
EC number：
Alternative names：(6Ckine) (Beta-chemokine exodus-2) (Small-inducible cytokine A21a) (Thymus-derived chemotactic agent 4) (TCA4)
Cleaved into：
GeneID：18829
Gene names (primary )：Ccl21a
Gene names (synonym )：Scya21 Scya21a
Gene names (ORF )：
Length：133
Mass：14558
Sequence：MAQMMTLSLLSLVLALCIPWTQGSDGGGQDCCLKYSQKKIPYSIVRGYRKQEPSLGCPIPAILFSPRKHSKPELCANPEEGWVQNLMRRLDQPPAPGKQSPGCRKNRGTSKSGKKGKGSKGCKRTEQTQPSRG
Tissue specificity：Expressed strongly in lung, spleen, thymus, peripheral and mesentric lymph nodes. Also expressed in the testis, kidney, liver, and heart.
Induction：
Developmental stage：
Protein families：Intercrine beta (chemokine CC) family