ZN653_MOUSE Q6YND2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q6YND2
Recommended name:Zinc finger protein 653
EC number:
Alternative names:(67 kDa zinc finger protein) (Zinc finger protein Zip67)
Cleaved into:
GeneID:319601
Gene names (primary ):Znf653
Gene names (synonym ):Zfp653 Zip67
Gene names (ORF ):
Length:615
Mass:67517
Sequence:MAERAPEPGAEAEAGAGGEAAAEEGAAGRKARGRPRLTESDRARRRLESRKKYDVRRVYLGEAHGPWVDLRRRSGWSDAKLAAYLISLERGQRSGRHGKPWEQVPKKPKRKKRRRRNVNCLKNVVIWYEDHKHRCPYEPHLAELDPTFGLYTTAVWQCEAGHRYFQDLHSPLKPLSDSEPDSDKVGSGLVAGSSDSSSSGSSSDSEEPPETQPAKASAAAAALTPASPTGSSGLITQEGVHIPFDVHHVESLAEQGTPLCQNPAGSGPEALETVVCVPVPMQVGTGPGTLFENMPQEALGEVVASCPVSGMVPGSQVIIIAGPGYDALTAEGIRLNVAAGGGTPSSSLGEEVPCAMMEGVAAYTQTEPEGTQHSTMDTTSIASIETKKEKEDLYMLKEEKEDSVAPELAELAATVPENAEAEAEVDGEELDSSEMSAIIYEIPKEPEKRRRSKRSRVMDADGLLEMFHCPYEGCSQVYVALSSFQNHVNLVHRKGKTKVCPHPGCGKKFYLSNHLRRHMIIHSGVREFTCETCGKSFKRKNHLEVHRRTHTGETPLQCEICGYQCRQRASLNWHMKKHTAEVQYNFTCDRCGKRFEKLDSVKFHTLKSHPDHKPT
Tissue specificity:Highly expressed in testis and spleen. Moderately expressed in lung, adrenal gland, uterus, and ovary. Very low expression in pancreas, heart, skeletal muscle, adipose tissue, kidney, and liver. {ECO:0000269|PubMed:12920234}.
Induction:
Developmental stage:
Protein families:Krueppel C2H2-type zinc-finger protein family