K2C1_MOUSE P04104
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P04104
Recommended name:Keratin, type II cytoskeletal 1
EC number:
Alternative names:(67 kDa cytokeratin) (Cytokeratin-1) (CK-1) (Keratin-1) (K1) (Type-II keratin Kb1)
Cleaved into:
GeneID:16678
Gene names (primary ):Krt1
Gene names (synonym ):Krt2-1
Gene names (ORF ):
Length:637
Mass:65606
Sequence:MSLQCSSRSLCRGGGGSRNFSSGSAGLVSFQRRSTSSSMRRSGGGGGGRFSGGGFCGSSGSGFGSKSLMNLGGGRSISKSVAGGGGSFCGGFGGGSYGGGGFGGGSYGGGGFGGGSFGGGGFGGSGFGGGLGGGGGFGSGGGFGGGRFGSMGPVCPPGGIQEVTINQSLLQPLNVEVDPQIQKVKSQEREQIKSLNDKFASFIDKVRFLEQQNQVLQTKWELLQQVDTTTRTQNLDPFFENYISILRRKVDSLKSDQSRMDSELKNMQDLVEEYRTKYEDEINKRTNAENEFVTIKKDVDSAYMTKVELQAKADALQQDIDFFSALYQMEMSQMQTQISETNVVLSMDNNRSLDLDGIISEVKAQYDSICQRSKAEAETFYQSKYEELQITAGKHGDSVRNTKMEISELNRMIQRLRSEIDGCKKQISQIQQNINDAEQRGEKALKDAQNKLNEIEDALSQCKEDLARLLRDFQELMNTKLALDMEIATYKKLLEGEEIRMSGECTPNVSVSVSTSHTSMSGSSSRGGGSGGGRYGGGGSYGGGSGGGSYGGSSGGGGSGGSYGGGSGGGSYGGGSGGGSSGSHRGGSGGGGGSSGGSYGGSSGGGRGGSSSGGGGVKSSGSSTVKFVSTSYSRGTK
Tissue specificity:
Induction:
Developmental stage:
Protein families:Intermediate filament family