ATP68_MOUSE P56379
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P56379
Recommended name：ATP synthase subunit ATP5MPL, mitochondrial
EC number：
Alternative names：(6.8 kDa mitochondrial proteolipid protein) (MLQ)
Cleaved into：
GeneID：70257
Gene names (primary )：Atp5mpl
Gene names (synonym )：Mp68
Gene names (ORF )：
Length：58
Mass：6698
Sequence：MFQTLIQKVWVPMKPYYTQVYQEIWVGVGLMSLIVYKIRSADKRSKALKGPAPAHGHH
Tissue specificity：
Induction：
Developmental stage：
Protein families：Small mitochondrial proteolipid family