5HT1D_MOUSE Q61224
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q61224
Recommended name：5-hydroxytryptamine receptor 1D
EC number：
Alternative names：(5-HT-1D) (5-HT1D) (Serotonin receptor 1D)
Cleaved into：
GeneID：15552
Gene names (primary )：Htr1d
Gene names (synonym )：Gpcr14
Gene names (ORF )：
Length：374
Mass：41594
Sequence：MSPPNQSLEGLPQEASNRSLNVTGAWDPEVLQALRISLVVVLSVITLATVLSNAFVLTTILLTKKLHTPANYLIGSLATTDLLVSILVMPISIAYTTTRTWNFGQILCDIWVSSDITCCTASILHLCVIALDRYWAITDALEYSKRRTAGHAAAMIAAVWIISICISIPPLFWRQATAHEEMSDCLVNTSQISYTIYSTCGAFYIPSILLIILYGRIYVAARSRILNPPSLYGKRFTTAQLITGSAGSSLCSLNPSLHESHTHTVGSPLFFNQVKIKLADSILERKRISAARERKATKTLGIILGAFIICWLPFFVVSLVLPICRDSCWIHPALFDFFTWLGYLNSLINPVIYTVFNEDFRQAFQKVVHFRKIS
Tissue specificity：Detected in the motor column in spinal cord, and in several cranial motor nuclei, including nucleus ambiguous, oculomotoris, trochelaris and abducens. Detected in gamma motor neurons in the lumbar spinal cord. Detected in proprioceptive sensory neurons in dorsal root ganglia. {ECO:0000269|PubMed:22273508}.
Induction：
Developmental stage：
Protein families：G-protein coupled receptor 1 family