KLRA3_MOUSE   Q64329


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q64329

Recommended name:Killer cell lectin-like receptor 3

EC number:

Alternative names:(5E6) (Lymphocyte antigen 49c) (Ly-49c) (Nk2.1) (T-cell surface glycoprotein Ly-49C)

Cleaved into:

GeneID:16634

Gene names  (primary ):Klra3

Gene names  (synonym ):Ly-49c Ly49C

Gene names  (ORF ):

Length:266

Mass:31311

Sequence:MSEPEVTYSTVRLHKSSGLQKLVRHEETQGPREVGNRKCSAPWQLIVKALGILCFLLLVTVAVLAVKIFQYNQHKQEINETLNHHHNCSNMQRAFNLKEEMLTNKSIDCRPSNETLEYIKREQDRWDSKTKTVLDSSRDTGRGVKYWFCYSTKCYYFIMNKTTWSGCKANCQHYSVPILKIEDEDELKFLQRHVIPENYWIGLSYDKKKKEWAWIDNGPSKLDMKIRKMNFKSRGCVFLSKARIEDIDCNIPYYCICGKKLDKFPD

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp