S10A6_MOUSE P14069
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P14069
Recommended name：Protein S100-A6
EC number：
Alternative names：(5B10) (Calcyclin) (Prolactin receptor-associated protein) (S100 calcium-binding protein A6)
Cleaved into：
GeneID：20200
Gene names (primary )：S100a6
Gene names (synonym )：Cacy
Gene names (ORF )：
Length：89
Mass：10051
Sequence：MACPLDQAIGLLVAIFHKYSGKEGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMDDLDRNKDQEVNFQEYVAFLGALALIYNEALK
Tissue specificity：
Induction：
Developmental stage：
Protein families：S-100 family