OASL2_MOUSE Q9Z2F2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9Z2F2
Recommended name：2'-5'-oligoadenylate synthase-like protein 2
EC number：EC 2.7.7.84
Alternative names：(54 kDa 2'-5'-oligoadenylate synthase-like protein) (p54 OASL) (M1204)
Cleaved into：
GeneID：23962
Gene names (primary )：Oasl2
Gene names (synonym )：
Gene names (ORF )：
Length：508
Mass：58767
Sequence：MDPFPDLYATPGDSLDHFLEHSLQPQRDWKEEGQDAWERIERFFREQCFRDELLLDQEVRVIKVVKGGSSGKGTTLNHRSDQDMILFLSCFSSFEEQARNREVVISFIKKRLIHCSRSLAYNIIVLTHREGKRAPRSLTLKVQSRKTDDIIWMDILPAYDALGPISRDSKPAPAIYETLIRSKGYPGDFSPSFTELQRHFVKTRPVKLKNLLRLVKFWYLQCLRRKYGRGAVLPSKYALELLTIYAWEMGTESSDSFNLDEGFVAVMELLVNYRDICIYWTKYYNFQNEVVRNFLKKQLKGDRPIILDPADPTNNLGRRKGWEQVAAEAAFCLLQVCCTTVGPSERWNVQRARDVQVRVKQTGTVDWTLWTNPYSPIRKMKAEIRREKNFGGELRISFQEPGGERQLLSSRKTLADYGIFSKVNIQVLETFPPEILVFVKYPGGQSKPFTIDPDDTILDLKEKIEDAGGPCAEDQVLLLDDEELEDDESLKELEIKDCDTIILIRVID
Tissue specificity：Strongly expressed in spleen dendritic cells, whereas, in bone marrow-derived dendritic cells, the amount increases during the maturation process. Expressed in many organs, the highest levels being in thymus, lung, and bone marrow. {ECO:0000269|PubMed:12396720}.
Induction：
Developmental stage：
Protein families：2-5A synthase family