4EBP2_MOUSE   P70445


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P70445

Recommended name:Eukaryotic translation initiation factor 4E-binding protein 2

EC number:

Alternative names:(4E-BP2) (eIF4E-binding protein 2) (Phosphorylated heat- and acid-stable protein regulated by insulin 2) (PHAS-II)

Cleaved into:

GeneID:13688

Gene names  (primary ):Eif4ebp2

Gene names  (synonym ):

Gene names  (ORF ):

Length:120

Mass:12898

Sequence:MSASAGGSHQPSQSRAIPTRTVAISDAAQLPQDYCTTPGGTLFSTTPGGTRIIYDRKFLLDRRNSPMAQTPPCHLPNIPGVTSPGALIEDSKVEVNNLNNLNNHDRKHAVGDEAQFEMDI

Tissue specificity:Enriched in brain. {ECO:0000269|PubMed:16237163}.

Induction:

Developmental stage:

Protein families:EIF4E-binding protein family


   💬 WhatsApp