LYRIC_MOUSE Q80WJ7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q80WJ7
Recommended name：Protein LYRIC
EC number：
Alternative names：(3D3/LYRIC) (Lysine-rich CEACAM1 co-isolated protein) (Metadherin) (Metastasis adhesion protein)
Cleaved into：
GeneID：67154
Gene names (primary )：Mtdh
Gene names (synonym )：Lyric
Gene names (ORF )：
Length：579
Mass：63846
Sequence：MAARSWQDELAQQAEEGSARLRELLSVGLGFLRTELGLDLGLEPKRYPGWVILVGTGALGLLLLFLLGYGWAAACAGARKKRRSPPRKREEAAPPTPAPDDLAQLKNLRSEEQKKKNRKKLPEKPKPNGRTVEVPEDEVVRNPRSITAKQAPETDKKNEKSKKNKKKSKSDAKAVQNSSRHDGKEVDEGAWETKISHREKRQQRKRDKVLTDSGSLDSTIPGIENIITVTTEQLTTASFPVGSKKNKGDSHLNVQVSNFKSGKGDSTLQVSSRLNENLTVNGGGWSEKSVKLSSQLSEEKWNSVPPASAGKRKTEPSAWTQDTGDTNANGKDWGRNWSDRSIFSGIGSTAEPVSQSTTSDYQWDVSRNQPYIDDEWSGLNGLSSADPSSDWNAPAEEWGNWVDEDRASLLKSQEPISNDQKVSDDDKEKGEGALPTGKSKKKKKKKKKQGEDNSHTQDTEDLEKDTREELPVNTSKARPKQEKACSLKTMSTSDPAEVLIKNSQPVKTLPPAISAEPSITLSKGDSDNSSSQVPPMLQDTDKPKSNAKQNSVPPSQTKSETNWESPKQIKKKKKARRET
Tissue specificity：In the mammary gland, expressed at the apical surface of epithelial cells lining ducts, as well as in the mammary fat pad. Not detected in the spleen, kidney, lung, or skin; minute amounts seen in the liver. Expressed in Purkinje neurons in the early postnatal and adult cerebellum. Overexpressed in mammary tumors (at protein level). {ECO:0000269|PubMed:15093543}.
Induction：
Developmental stage：
Protein families：