G45IP_MOUSE   Q9CR59


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9CR59

Recommended name:Growth arrest and DNA damage-inducible proteins-interacting protein 1

EC number:

Alternative names:(39S ribosomal protein L59, mitochondrial) (MRP-L59)

Cleaved into:

GeneID:102060

Gene names  (primary ):Gadd45gip1

Gene names  (synonym ):Mrpl59

Gene names  (ORF ):

Length:222

Mass:25820

Sequence:MAALAMRSGYLLRLSVALGPRSRSYRAPPPPRRRPGPHSPDPENLLTPRWQLTPRYVAKQFGRHGAISGVPPASLWPTPEQLRELEAEEQEWYPSLATMQESLRLQQQALEARRQAREQRIAECMAKMPQMIENWRKQKRERWEKIQADKERRARLQAEAQERLGYHVDPRSARFQELLQDLDKQQRKRLKEERQRQKKEARIAAMASAEAQDSAVSGEPSS

Tissue specificity:

Induction:

Developmental stage:

Protein families:Mitochondrion-specific ribosomal protein mL64 family


   💬 WhatsApp