ICT1_MOUSE   Q8R035


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8R035

Recommended name:Peptidyl-tRNA hydrolase ICT1, mitochondrial

EC number:EC 3.1.1.29

Alternative names:(39S ribosomal protein L58, mitochondrial) (MRP-L58) (Immature colon carcinoma transcript 1 protein homolog)

Cleaved into:

GeneID:68572

Gene names  (primary ):Mrpl58

Gene names  (synonym ):Ict1

Gene names  (ORF ):

Length:206

Mass:23477

Sequence:MATAWGLRWGLSRTGTLLLAPPARCARRALHRQVDGTTFQSIYSLDKLYPESKGADTAWKVPEHAKQASSYIPLDRLSISYCRSSGPGGQNVNKVNSKAEVRFHLASADWIEEPVRQKIALTHKNKINKAGELVLTSESSRYQFRNLAECLQKIRDMIAEASQVPKEPSKEDARLQRLRIEKMNRERLRQKRLNSALKTSRRMTMD

Tissue specificity:

Induction:

Developmental stage:

Protein families:Prokaryotic/mitochondrial release factor family, Mitochondrion-specific ribosomal protein mL62 subfamily


   💬 WhatsApp