LAT_MOUSE   O54957


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O54957

Recommended name:Linker for activation of T-cells family member 1

EC number:

Alternative names:(36 kDa phospho-tyrosine adapter protein) (pp36) (p36-38)

Cleaved into:

GeneID:16797

Gene names  (primary ):Lat

Gene names  (synonym ):

Gene names  (ORF ):

Length:242

Mass:26015

Sequence:MEADALSPVGLGLLLLPFLVTLLAALCVRCRELPVSYDSTSTESLYPRSILIKPPQITVPRTPAVSYPLVTSFPPLRQPDLLPIPRSPQPLGGSHRMPSSQQNSDDANSVASYENQEPACKNVDADEDEDDYPNGYLVVLPDSSPAAVPVVSSAPVPSNPDLGDSAFSVESCEDYVNVPESEESAEASLDGSREYVNVSPEQQPVTRAELASVNSQEVEDEGEEEGVDGEEAPDYENLQELN

Tissue specificity:Expressed in T-cells and mast cells. {ECO:0000269|PubMed:10843385}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp