PM34_MOUSE O70579
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O70579
Recommended name：Peroxisomal membrane protein PMP34
EC number：
Alternative names：(34 kDa peroxisomal membrane protein) (Solute carrier family 25 member 17)
Cleaved into：
GeneID：20524
Gene names (primary )：Slc25a17
Gene names (synonym )：Pmp34 Pmp35
Gene names (ORF )：
Length：307
Mass：34413
Sequence：MASVLSYESLVHAVAGAVGSVTAMTVFFPLDTARLRLQVDEKRKSKTTHAVLLEIIKEEGLLAPYRGWFPVISSLCCSNFVYFYTFNSLKAVWVKGQRSSTGKDLVVGFVAGVVNVLLTTPLWVVNTRLKLQGAKFRNEDIIPTNYKGIIDAFHQIIRDEGILALWNGTFPSLLLVFNPAIQFMFYEGLKRQLLKKRMKLSSLDVFIIGAIAKAIATTVTYPMQTVQSILRFGRHRLNPENRTLGSLRNVLSLLHQRVKRFGIMGLYKGLEAKLLQTVLTAALMFLVYEKLTAATFTVMGLKSTHKH
Tissue specificity：Expressed in liver.
Induction：
Developmental stage：
Protein families：Mitochondrial carrier (TC 2.A.29) family