SPF30_MOUSE   Q8BGT7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8BGT7

Recommended name:Survival of motor neuron-related-splicing factor 30

EC number:

Alternative names:(30 kDa splicing factor SMNrp) (SMN-related protein) (Survival motor neuron domain-containing protein 1)

Cleaved into:

GeneID:76479

Gene names  (primary ):Smndc1

Gene names  (synonym ):Smnr Spf30

Gene names  (ORF ):

Length:238

Mass:26753

Sequence:MSEDLAKQLASYKAQLQQVEAALSGNGENEDLLKLKKDLQEVIELTKDLLSTQPSETLASSDSFASTQPTHSWKVGDKCMAVWSEDGQCYEAEIEEIDEENGTAAITFAVYGNAEVTPLLNLKPVEEGRKAKEDSGNKPMSKKEMIAQQREYKKKKALKKAQRIKELEQEREDQKVKWQQFNNRAYSKNKKGQVKRSIFASPESVTGKVGVGTCGIADKPMTQYQDTSKYNVRHLMPQ

Tissue specificity:

Induction:

Developmental stage:

Protein families:SMN family


   💬 WhatsApp