3BHS5_MOUSE Q61694
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q61694
Recommended name：NADPH-dependent 3-keto-steroid reductase Hsd3b5
EC number：EC 1.1.1.270
Alternative names：(3 beta-hydroxysteroid dehydrogenase type 5) (3 beta-hydroxysteroid dehydrogenase type V) (3 beta-HSD V) (Dihydrotestosterone 3-ketoreductase) (EC 1.1.1.210)
Cleaved into：
GeneID：15496
Gene names (primary )：Hsd3b5
Gene names (synonym )：
Gene names (ORF )：
Length：373
Mass：41892
Sequence：MPGWSCLVTGAGGFLGQRIVRMLVQEEELQEIRALFRTFGRKHEEELSKLQTKAKVRVLKGDILDAQCLKRACQGMSAVIHTAAAIDPLGAASRQTILDVNLKGTQLLLDACVEASVPTFIYSSSVLVAGPNSYKEIILNAHEEEHRESTWPNPYPYSKRMAEKAVLATNGRLLKNGGTLHTCALRLPFIYGEECQVTSTTVKTALKNNSIIKKNATFSIANPVYVGNAAWAHILAARSLQDPKKSPSIQGQFYYISDNTPHQSYDDLNYTLSKEWGLCLDSGWSLPLSLLYWLAFLLETVSFLLRPVYNYRPPFNRLLITVLNSVFTISYKKAQRDLGYQPLVSWEEAKQKTSEWIGTLVKQHRETLHKKSQ
Tissue specificity：Expressed in the male liver, starting in late puberty. {ECO:0000269|PubMed:7491113}.
Induction：
Developmental stage：
Protein families：3-beta-HSD family