8ODP_MOUSE P53368
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P53368
Recommended name：7,8-dihydro-8-oxoguanine triphosphatase
EC number：EC 3.6.1.55
Alternative names：(2-hydroxy-dATP diphosphatase) (8-oxo-dGTPase) (Nucleoside diphosphate-linked moiety X motif 1) (Nudix motif 1)
Cleaved into：
GeneID：17766
Gene names (primary )：Nudt1
Gene names (synonym )：Mth1
Gene names (ORF )：
Length：156
Mass：17908
Sequence：MSTSRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGAKRELLEESGLSVDTLHKVGHISFEFVGSPELMDVHIFSADHVHGTPTESEEMRPQWFQLDQIPFADLWPDDSYWFPLLLQKKKFCGHFKFQDQDTILSYSLREVDSF
Tissue specificity：High expression levels detected in thymus, liver, spleen, kidney, testis and large intestine, with lower levels detected in brain, heart, lung and stomach (at protein level). Expressed in kidney, liver and small intestine. {ECO:0000269|PubMed:7592783}.
Induction：
Developmental stage：
Protein families：Nudix hydrolase family