PSD13_MOUSE   Q9WVJ2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9WVJ2

Recommended name:26S proteasome non-ATPase regulatory subunit 13

EC number:

Alternative names:(26S proteasome regulatory subunit RPN9) (26S proteasome regulatory subunit S11) (26S proteasome regulatory subunit p40.5)

Cleaved into:

GeneID:23997

Gene names  (primary ):Psmd13

Gene names  (synonym ):

Gene names  (ORF ):

Length:376

Mass:42809

Sequence:MKDVPAFLQQSQSSGPGQAAVWHRLEELYTKKLWHQLTLEVLDFVQDPCFAQGDGLIKLYENFISEFEHRVNPLSLVEIILHVVRQMTDPNVALTFLEKTREKVKSSDEAVILCKTAIGALKLNIGDLQATKETIEDVEEMLNNLPGVTSVHSRFYDLSSKYYQTIGNHASYYKDALRFLGCVDIKDLPVSEQQERAFTLGLAGLLGEGVFNFGELLMHPVLESLRDTDRQWLIDTLYAFNSGAVDRFQTLKCAWGQQPDLAANEAQLLRKIQLLCLMEMTFTRPANHRQLTFEEIAKSAKITVNKVELLVMKALSVGLVRGSIDEVDKRVHMTWVQPRVLDLQQIKGMKDRLELWCTDVKSMEMLVEHQAQDILT

Tissue specificity:

Induction:

Developmental stage:

Protein families:Proteasome subunit S11 family


   💬 WhatsApp