SEM1_MOUSE   P60897


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P60897

Recommended name:26S proteasome complex subunit SEM1

EC number:

Alternative names:(26S proteasome complex subunit DSS1) (Deleted in split hand/split foot protein 1 homolog) (Split hand/foot deleted protein 1 homolog) (Split hand/foot malformation type 1 protein homolog)

Cleaved into:

GeneID:20422

Gene names  (primary ):Sem1

Gene names  (synonym ):Dss1 Shfdg1 Shfm1

Gene names  (ORF ):

Length:70

Mass:8278

Sequence:MSEKKQPVDLGLLEEDDEFEEFPAEDWAGLDEDEDAHVWEDNWDDDNVEDDFSNQLRAELEKHGYKMETS

Tissue specificity:

Induction:

Developmental stage:

Protein families:DSS1/SEM1 family


   💬 WhatsApp