STAC2_MOUSE   Q8R1B0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8R1B0

Recommended name:SH3 and cysteine-rich domain-containing protein 2

EC number:

Alternative names:(24b2/STAC2) (Src homology 3 and cysteine-rich domain-containing protein 2)

Cleaved into:

GeneID:217154

Gene names  (primary ):Stac2

Gene names  (synonym ):

Gene names  (ORF ):

Length:408

Mass:44793

Sequence:MTEMSEKENEPDDAATHTPPGTVSTLQETKLQRFKRSLSLKTILRSKSVENFFLRSGSELKCPTEVLLTPPTPLPPPSPPPASTDRGLPTPTPSPCPVPRPLAPLKPVRLHSFQEHVFKRASPCELCHQLIVGNSKQGLRCKTCKVSVHLWCSEEISHQQCPGKTSTSFRRNFSSPLLVHAPPPACAMNKESPPTGTSGKVDPVYETLRYGTSLALMNRSSFSSTSESPTRSLSERDELTEDGEGSIRSSEEGPGDSVFTAPAESEGSGPEEKSPGQQPPKLPLRKDVGPMYSYVALYKFLPQENNDLALQPGDRIMLVDDSNEDWWKGKIGDRVGFFPANFVQRVRPGENVWRCCQPFSGNKEQGYMSLKENQICVGVSRSKDSDGFIRVSSGKKRGLVPADSLAEI

Tissue specificity:Detected in cerebellum, forebrain and midbrain, and in the eye. {ECO:0000269|PubMed:23818578}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp