PRDX6_MOUSE   O08709


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O08709

Recommended name:Peroxiredoxin-6

EC number:EC 1.11.1.27

Alternative names:(1-Cys peroxiredoxin) (1-Cys PRX) (Acidic calcium-independent phospholipase A2) (aiPLA2) (Antioxidant protein 2) (Glutathione-dependent peroxiredoxin) (Lysophosphatidylcholine acyltransferase 5) (LPC acyltransferase 5) (LPCAT-5) (Lyso-PC acyltransferase 5) (Non-selenium glutathione peroxidase) (NSGPx)

Cleaved into:

GeneID:11758

Gene names  (primary ):Prdx6

Gene names  (synonym ):Aop2 Ltw4 Prdx5

Gene names  (ORF ):

Length:224

Mass:24871

Sequence:MPGGLLLGDEAPNFEANTTIGRIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPEFAKRNVKLIALSIDSVEDHLAWSKDINAYNGETPTEKLPFPIIDDKGRDLAILLGMLDPVEKDDNNMPVTARVVFIFGPDKKLKLSILYPATTGRNFDEILRVVDSLQLTGTKPVATPVDWKKGESVMVVPTLSEEEAKQCFPKGVFTKELPSGKKYLRYTPQP

Tissue specificity:Highly expressed in heart, kidney and liver. Moderate expression in brain and stomach. Very low levels in intestine.

Induction:

Developmental stage:

Protein families:Peroxiredoxin family, Prx6 subfamily


   💬 WhatsApp