TM45A_MOUSE Q60774
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q60774
Recommended name：Transmembrane protein 45A
EC number：
Alternative names：(19.5) (Dermal papilla-derived protein 7 homolog)
Cleaved into：
GeneID：
Gene names (primary )：Tmem45a
Gene names (synonym )：Derp7
Gene names (ORF )：
Length：273
Mass：31343
Sequence：MGSFKGHALPGSFFFAMGFWWTMKNILKSVYKRQTRTCYLNSKTLLRRTEIWEGVVVLLMSLTGIAGEQFISGGPALILHKDGQWNQILGWHHTTMYLFFGLQGITQIICFTTNVLPLSSSKLMLSIAIFVETFMFYNHTHGREMIDIFVHQLLVFVGTFSGLVAFLEFLVKNNALLELLRCSLLMFQGTWFWQMAFVLYPPCGSATWNLSDIQNKMFLSMCFCWHYASILILIGVKYALANWLVKSRLRKGCTSEVGLLKHADREQESEEEV
Tissue specificity：
Induction：
Developmental stage：
Protein families：TMEM45 family