DHB5_MOUSE   P70694


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P70694

Recommended name:Estradiol 17 beta-dehydrogenase 5

EC number:EC 1.1.1.-

Alternative names:(17-beta-HSD 5)

Cleaved into:

GeneID:83702

Gene names  (primary ):Akr1c6

Gene names  (synonym ):Hsd17b5

Gene names  (ORF ):

Length:323

Mass:37048

Sequence:MDSKQQTVRLSDGHFIPILGFGTYAPQEVPKSKATEATKIAIDAGFRHIDSASMYQNEKEVGLAIRSKIADGTVKREDIFYTSKVWCTFHRPELVRVCLEQSLKQLQLDYVDLYLIHFPMAMKPGENYLPKDENGKLIYDAVDICDTWEAMEKCKDAGLAKSIGVSNFNRRQLEKILKKPGLKYKPVCNQVECHPYLNQGKLLDFCRSKDIVLVAYSALGSHREKQWVDQSSPVLLDNPVLGSMAKKYNRTPALIALRYQLQRGVVVLAKSFSEKRIKENMQVFEFQLTSEDMKVLDDLNKNIRYISGSSFKDHPDFPFWDEY

Tissue specificity:Mainly found in liver. Also expressed weakly in kidney. {ECO:0000269|PubMed:10500239}.

Induction:

Developmental stage:

Protein families:Aldo/keto reductase family


   💬 WhatsApp