PGDH_MOUSE   Q8VCC1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8VCC1

Recommended name:15-hydroxyprostaglandin dehydrogenase [NAD(+)]

EC number:

Alternative names:(15-PGDH) (Prostaglandin dehydrogenase 1)

Cleaved into:

GeneID:15446

Gene names  (primary ):Hpgd

Gene names  (synonym ):Pgdh1

Gene names  (ORF ):

Length:269

Mass:29181

Sequence:MHVNGKVALVTGAAQGIGKAFAEALLLHGAKVALVDWNLEAGVKCKAALDEQFEPQKTLFVQCDVADQKQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEQTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGIIGFTRSAAMAANLMKSGVRLNVICPGFVDTPILESIEKEENMGQYIEYKDQIKAMMKFYGVLHPSTIANGLINLIEDDALNGAIMKITASKGIHFQDYDISPLLVKAPLTS

Tissue specificity:Expressed in proximal convoluted tubules of the kidney, where it colocalizes with the prostaglandin transporter SLC22A22 (at protein level) (PubMed:20448048). Expressed in lung, intestine, stomach and liver (PubMed:8950170). {ECO:0000269|PubMed:20448048, ECO:0000269|PubMed:8950170}.

Induction:

Developmental stage:

Protein families:Short-chain dehydrogenases/reductases (SDR) family


   💬 WhatsApp