TXD17_MOUSE   Q9CQM5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9CQM5

Recommended name:Thioredoxin domain-containing protein 17

EC number:

Alternative names:(14 kDa thioredoxin-related protein) (TRP14) (Protein 42-9-9) (Thioredoxin-like protein 5)

Cleaved into:

GeneID:52700

Gene names  (primary ):Txndc17

Gene names  (synonym ):Txnl5

Gene names  (ORF ):

Length:123

Mass:14015

Sequence:MATFEEVSVLGFEEFDKAVKEHEGKTIFAYFSGSKDTEGKSWCPDCVEAEPVIREGLKHVTEDCVFIYCQVGDKPYWKDPNNDFRQKLKITAVPTLLKYGTPQKLVESECCQSSLVEMIFSED

Tissue specificity:

Induction:

Developmental stage:

Protein families:Thioredoxin family


   💬 WhatsApp