UBE2H_MOUSE   P62257


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P62257

Recommended name:Ubiquitin-conjugating enzyme E2 H

EC number:EC 2.3.2.23

Alternative names:((E3-independent) E2 ubiquitin-conjugating enzyme H) (E2 ubiquitin-conjugating enzyme H) (UBCH2) (Ubiquitin carrier protein H) (Ubiquitin-conjugating enzyme E2-20K) (Ubiquitin-protein ligase H)

Cleaved into:

GeneID:22214

Gene names  (primary ):Ube2h

Gene names  (synonym ):

Gene names  (ORF ):

Length:183

Mass:20655

Sequence:MSSPSPGKRRMDTDVVKLIESKHEVTILGGLNEFVVKFYGPQGTPYEGGVWKVRVDLPDKYPFKSPSIGFMNKIFHPNIDEASGTVCLDVINQTWTALYDLTNIFESFLPQLLAYPNPIDPLNGDAAAMYLHRPEEYKQKIKEYIQKYATEEALKEQEEGTGDSSSESSMSDFSEDEAQDMEL

Tissue specificity:Detected in reticulocytes, lung, brain and skeletal muscle (at protein level) (PubMed:7761435). Ubiquitous. Detected in cardiac muscle, brain, spleen, lung, liver, skeletal muscle, kidney andmso testis (PubMed:7590289). {ECO:0000269|PubMed:7590289, ECO:0000269|PubMed:7761435}.

Induction:

Developmental stage:

Protein families:Ubiquitin-conjugating enzyme family


   💬 WhatsApp