GLUC_MOUSE P55095
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P55095
Recommended name：Pro-glucagon [Cleaved into: Glicentin; Glicentin-related polypeptide
EC number：
Alternative names：(GRPP); Oxyntomodulin (OXM) (OXY); Glucagon; Glucagon-like peptide 1 (GLP-1); Glucagon-like peptide 1(7-37) (GLP-1(7-37)); Glucagon-like peptide 1(7-36) (GLP-1(7-36)); Glucagon-like peptide 2 (GLP-2)]
Cleaved into：
GeneID：14526
Gene names (primary )：Gcg
Gene names (synonym )：
Gene names (ORF )：
Length：180
Mass：20906
Sequence：MKTIYFVAGLLIMLVQGSWQHALQDTEENPRSFPASQTEAHEDPDEMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIAEELGRRHADGSFSDEMSTILDNLATRDFINWLIQTKITDKK
Tissue specificity：[Glucagon]: Secreted in the A cells of the islets of Langerhans. {ECO:0000269|PubMed:22037645}.; [Glucagon-like peptide 1]: Secreted in the A cells of the islets of Langerhans (PubMed:22037645). Secreted from enteroendocrine L cells throughout the gastrointestinal tract (PubMed:22037645). Also secreted in selected neurons in the brain. {ECO:0000269|PubMed:22037645}.; [Glucagon-like peptide 2]: Secreted from enteroendocrine cells throughout the gastrointestinal tract. Also secreted in selected neurons in the brain.; [Glicentin]: Secreted from enteroendocrine cells throughout the gastrointestinal tract.; [Oxyntomodulin]: Secreted from enteroendocrine cells throughout the gastrointestinal tract.
Induction：[Glucagon]: Release is stimulated by hypoglycemia and inhibited by hyperglycemia, insulin, and somatostatin. {ECO:0000305|PubMed:10605628, ECO:0000305|PubMed:12626323}.; [Glucagon-like peptide 1]: Production by pancreatic and inestinal L cells is increased by exercise in an IL6-dependent manner (PubMed:22037645). High-fat diet increases pancreatic content (PubMed:22037645). {ECO:0000269|PubMed:22037645}.; [Glucagon-like peptide 2]: Induced in response to nutrient ingestion. {ECO:0000305|PubMed:10322410, ECO:0000305|PubMed:10605628, ECO:0000305|PubMed:12554744, ECO:0000305|PubMed:14719035}.
Developmental stage：
Protein families：Glucagon family