IFI3_MOUSE O35368
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O35368
Recommended name:Interferon-activable protein 203
EC number:
Alternative names:(Ifi-203) (Interferon-inducible protein p203)
Cleaved into:
GeneID:15950
Gene names (primary ):Ifi203
Gene names (synonym ):
Gene names (ORF ):
Length:408
Mass:46300
Sequence:MAEYKNIVLLKGLENMEDYQFRTVKSLLRKELKLTKKMQEDYDRIQLADWMEDKFPKDAGLDKLIKVCEHIKDLKDLAKKLKTEKAKVQEKKKGKCKTAGKKKGQDELSSSESLFINKESYKSVPSSKKKRKQITKTEGGKKKKLTQEQAQLPETSGTNIKKEEDCLQNPHKSPPTPSSSSSNKAPRRGTVPKEPSREEGHHQGPKQVMVLKVTEPFTYDFEETKRMFHATVATETEFFRVKVFDTALMSKFIPGKIIAISHYIGCNGFLEIYRASCVSDVNINPTMIISNTLSESAIATPKISYLLSQAKGTFVNGEFVVFKKSERHECICYGIGDDTGKMAVVVYGRLTNVRCEPGSKLRLVCFELTSTKDVCLLRSVRHSYMQVINEGKPLNPDSVRRNSLEPYF
Tissue specificity:Constitutively expressed in the thymus, bone marrow and spleen. Isoform 1 and isoform 3 are present in liver (at protein level). {ECO:0000269|PubMed:17981725}.
Induction:[Isoform 1]: Induced by alpha interferon (at protein level). {ECO:0000269|PubMed:17981725}.; [Isoform 3]: Induced by alpha interferon (at protein level). {ECO:0000269|PubMed:17981725}.
Developmental stage:
Protein families:HIN-200 family