METL8_MOUSE A2AUU0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:A2AUU0
Recommended name：mRNA N(3)-methylcytidine methyltransferase METTL8
EC number：EC 2.1.1.-
Alternative names：(Methyltransferase-like protein 8) (Tension-induced/inhibited protein)
Cleaved into：
GeneID：228019
Gene names (primary )：Mettl8
Gene names (synonym )：Tip
Gene names (ORF )：
Length：281
Mass：31670
Sequence：MNVIWRSCICRLRQGKVPHRCQSGVHPVAPLGSRILTDPAKVFEHNMWDHMQWSKEEEDAARKKVEENSATRVAPEEQVKFESDANKYWDIFYQTHKNKFFKNRNWLLREFPEILPVNQNTKEKVGESSWDQVGSSISRTQGTETHCQESFVSPEPGSRGRSAPDPDLEEYSKGPGKTEPFPGSNATFRILEVGCGAGNSVFPILNTLQNIPGSFLYCCDFASEAVELVKSHESYSEAQCSAFIHDVCDDGLAYPFPDGILDVVLLVFVLSSIHPDRALFI
Tissue specificity：Isoform 5: Absent in undifferentiated embryonic lung mesenchymal cells, but expression is induced by stretch (PubMed:15992539). Isoform 4: Expressed in undifferentiated progenitor cells, while its expression is inhibited by stretch (PubMed:15992539). Isoform 2: Absent in embryonic lung but is induced in a fibroblast cell line by stretch (PubMed:15992539). Isoform 7: Expressed in mature adipose tissue (PubMed:15992539). {ECO:0000269|PubMed:15992539}.
Induction：[Isoform 5]: Induced in stretched embryonic lung mesenchymal cells. {ECO:0000269|PubMed:15992539}.
Developmental stage：
Protein families：Methyltransferase superfamily, METL family