DT3UO_MOUSE A0A2R8VHR8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:A0A2R8VHR8
Recommended name：DDIT3 upstream open reading frame protein
EC number：
Alternative names：(Alternative DDIT3 proteins) (AltDDIT3)
Cleaved into：
GeneID：
Gene names (primary )：Ddit3
Gene names (synonym )：
Gene names (ORF )：
Length：34
Mass：4240
Sequence：MLKMSGWQRQSQNNSRNLRRECSRRKCIFIHHHT
Tissue specificity：
Induction：[Isoform AltDDIT3]: Produced in absence of stress: this uORF is translated, thereby preventing translation of downstream ORF, the stress effector DDIT3/CHOP (PubMed:21285359). This uORF is not translated in response to stress (PubMed:21285359). {ECO:0000269|PubMed:21285359}.
Developmental stage：
Protein families：