NR1D2_MOUSE Q60674
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q60674
Recommended name：Nuclear receptor subfamily 1 group D member 2
EC number：
Alternative names：(Orphan nuclear receptor RVR) (Rev-erb-beta)
Cleaved into：
GeneID：353187
Gene names (primary )：Nr1d2
Gene names (synonym )：
Gene names (ORF )：
Length：576
Mass：64302
Sequence：MELNAGGVIAYISSSSSASSPASCHSEGSENSFQSSSSSVPSSPNSSNCDANGNPKNADISSIDGVLKSDRTDCPVKTGKTSAPGMTKSHSGMTKFSGMVLLCKVCGDVASGFHYGVHACEGCKGFFRRSIQQNIQYKKCLKNENCSIMRMNRNRCQQCRFKKCLSVGMSRDAVRFGRIPKREKQRMLIEMQSAMKTMMNTQFSGHLQNDTLAEQHDQSALPAQEQLRPKSQLEQENIKNTPSDFAKEEVIGMVTRAHKDTFLYNQEHRENSSESMPPQRGERIPRNMEQYNLNQDHRGSGIHNHFPCSERQQHLSGQYKGRNIMHYPNGHAVCIANGHCMNFSSAYTQRVCDRIPVGGCSQTENRNSYLCNTGGRMHLVCPMSKSPYVDPQKSGHEIWEEFSMSFTPAVKEVVEFAKRIPGFRDLSQHDQVNLLKAGTFEVLMVRFASLFDAKERTVTFLSGKKYSVDDLHSMGAGDLLSSMFEFSEKLNALQLSDEEMSLFTAVVLVSADRSGIENVNSVEALQETLIRALRTLIMKNHPNEASIFTKLLLKLPDLRSLNNMHSEELLAFKVHP
Tissue specificity：Ubiquitious. Expressed abundantly in skeletal muscle and brown adipose tissue. Expressed during skeletal muscle myogenesis. {ECO:0000269|PubMed:15623503, ECO:0000269|PubMed:18454201}.
Induction：Activated by the CLOCK-ARNTL/BMLA1 heterodimer and DBP and repressed by CRY1. {ECO:0000269|PubMed:23221024}.
Developmental stage：
Protein families：Nuclear hormone receptor family, NR1 subfamily