CCL6_MOUSE P27784
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P27784
Recommended name：C-C motif chemokine 6
EC number：
Alternative names：(Protein C10) (Small-inducible cytokine A6)
Cleaved into：CCL6(22-95); CCL6(23-95)
GeneID：20305
Gene names (primary )：Ccl6
Gene names (synonym )：C10 Scya6
Gene names (ORF )：
Length：116
Mass：12984
Sequence：MRNSKTAISFFILVAVLGSQAGLIQEMEKEDRRYNPPIIHQGFQDTSSDCCFSYATQIPCKRFIYYFPTSGGCIKPGIIFISRRGTQVCADPSDRRVQRCLSTLKQGPRSGNKVIA
Tissue specificity：Expressed in myelopoietic bone marrow cultures stimulated by GM-CSF.
Induction：Associated with stimuli that promote myeloid differentiation.
Developmental stage：
Protein families：Intercrine beta (chemokine CC) family