ID3_MOUSE P41133
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P41133
Recommended name：DNA-binding protein inhibitor ID-3
EC number：
Alternative names：(ID-like protein inhibitor HLH 462) (Inhibitor of DNA binding 3) (Inhibitor of differentiation 3)
Cleaved into：
GeneID：15903
Gene names (primary )：Id3
Gene names (synonym )：Hlh462 Id-3 Idb3
Gene names (ORF )：
Length：119
Mass：13089
Sequence：MKALSPVRGCYEAVCCLSERSLAIARGRGKSPSTEEPLSLLDDMNHCYSRLRELVPGVPRGTQLSQVEILQRVIDYILDLQVVLAEPAPGPPDGPHLPIQTAELTPELVISKDKRSFCH
Tissue specificity：Expressed by myoblasts (at protein level). {ECO:0000269|PubMed:23824195}.
Induction：By a variety of mitogenic agents in serum starved cells. Expressed in a circadian manner in the suprachiasmatic nucleus (SCN) of the brain and heart with peak levels between CT16 and CT20 in SCN and between CT8 and CT12 in the heart. {ECO:0000269|PubMed:19217292}.
Developmental stage：
Protein families：