GSC_MOUSE Q02591
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q02591
Recommended name：Homeobox protein goosecoid
EC number：
Alternative names：
Cleaved into：
GeneID：14836
Gene names (primary )：Gsc
Gene names (synonym )：
Gene names (ORF )：
Length：256
Mass：27980
Sequence：MPASMFSIDNILAARPRCKDAVLPVAPSAAAPVVFPALHGDSLYGAGGGTSSDYGAFYPRPVAPGGAGLPAAVGSSRLGYNSYFYGQLHVQAAPVGPACCGAVPPLGAQQCSCVPTPPGYEGPGSVLVSPVPHQMLPYMNVGTLSRTELQLLNQLHCRRKRRHRTIFTDEQLEALENLFQETKYPDVGTREQLARKVHLREEKVEVWFKNRRAKWRRQKRSSSEESENAEKWNKTSSKASPEKREEEGKSDLDSDS
Tissue specificity：In early gastrulation, expressed in the dorsal lip. In later stages of development found in head, limbs and body wall. In the embryo, expressed in the postotic cranial neural crest cells, the frontonasal prominence, the first branchial arch and cleft, and specific regions of large joints. {ECO:0000269|PubMed:24290375}.
Induction：By activin.
Developmental stage：
Protein families：Paired homeobox family, Bicoid subfamily