T53I1_MOUSE Q9QXE4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9QXE4
Recommended name：Tumor protein p53-inducible nuclear protein 1
EC number：
Alternative names：(Stress-induced protein) (Thymus-expressed acidic protein) (TEAP) (p53-dependent damage-inducible nuclear protein 1) (p53DINP1)
Cleaved into：
GeneID：60599
Gene names (primary )：Trp53inp1
Gene names (synonym )：Sip
Gene names (ORF )：
Length：239
Mass：26935
Sequence：MFQRLNKMFVGEVTTSSSQEPEFSEKEDDEWILVDFIDTCPGFSAEEEEEDEDIGEESSAEHTSVFSCLPASLECLTDTSDSCFLQFESCPMEESWFITPPPCFTAGGLTTIKVETSPMENLLIEHPSMSVYAVHNSCPGLSEASCGNDEYNSSGPRMEAQSEMGKHIHCCVAALAAQATFLEQPKSFRPSQWIKGHSERQSLNRNGLRRQNLTRDCHTRQMKHSGWVVHQPCPRQYNY
Tissue specificity：Ubiquitously expressed with highest levels in the thymus. {ECO:0000269|PubMed:10630289, ECO:0000269|PubMed:11557757}.
Induction：By adriamycin, methymethane sulfonate, ethanol, H(2)O(2), ultraviolet irradiation and heat shock. Rapidly induced in acinar cells of the pancreas with acute pancreatitis upon caerulein treatment. {ECO:0000269|PubMed:11557757}.
Developmental stage：
Protein families：