DFB41_MOUSE Q30KP6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q30KP6
Recommended name:Beta-defensin 41
EC number:
Alternative names:(BD-41) (mBD-41) (Defensin, beta 41)
Cleaved into:
GeneID:77673
Gene names (primary ):Defb41
Gene names (synonym ):Defb16 Defb17 Gm15386
Gene names (ORF ):
Length:65
Mass:7663
Sequence:MKFHLFFFILLFGATILTAKKSYPEYGSLDLRKECKMRRGHCKLQCSEKELRISFCIRPGTHCCM
Tissue specificity:Isoform 2 is epididymis-specific and expressed mainly in the proximal caput. {ECO:0000269|PubMed:16023745}.
Induction:By androgens. {ECO:0000269|PubMed:16023745}.
Developmental stage:
Protein families:Beta-defensin family