DEFB3_MOUSE   Q9WTL0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9WTL0

Recommended name:Beta-defensin 3

EC number:

Alternative names:(BD-3) (mBD-3) (Defensin, beta 3)

Cleaved into:

GeneID:27358

Gene names  (primary ):Defb3

Gene names  (synonym ):Bd3

Gene names  (ORF ):

Length:63

Mass:7126

Sequence:MRIHYLLFAFLLVLLSPPAAFSKKINNPVSCLRKGGRCWNRCIGNTRQIGSCGVPFLKCCKRK

Tissue specificity:Highest expression in salivary glands, epididymis, ovary and pancreas and to a lesser extent in lung, liver and brain. Low or no expression in skeletal muscle and tongue. {ECO:0000269|PubMed:10377137, ECO:0000269|PubMed:10922379}.

Induction:By bacterial infection. {ECO:0000269|PubMed:10377137}.

Developmental stage:

Protein families:Beta-defensin family, LAP/TAP subfamily


   💬 WhatsApp