CCRL2_MOUSE O35457
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O35457
Recommended name:C-C chemokine receptor-like 2
EC number:
Alternative names:(Chemokine receptor CCR11) (G-protein coupled beta chemokine receptor) (Lipopolysaccharide-inducible C-C chemokine receptor) (L-CCR)
Cleaved into:
GeneID:54199
Gene names (primary ):Ccrl2
Gene names (synonym ):Ccr11 Lccr
Gene names (ORF ):
Length:360
Mass:40745
Sequence:MDNYTVAPDDEYDVLILDDYLDNSGPDQVPAPEFLSPQQVLQFCCAVFAVGLLDNVLAVFILVKYKGLKNLGNIYFLNLALSNLCFLLPLPFWAHTAAHGESPGNGTCKVLVGLHSSGLYSEVFSNILLLVQGYRVFSQGRLASIFTTVSCGIVACILAWAMATALSLPESVFYEPRMERQKHKCAFGKPHFLPIEAPLWKYVLTSKMIILVLAFPLLVFIICCRQLRRRQSFRERQYDLHKPALVITGVFLLMWAPYNTVLFLSAFQEHLSLQDEKSSYHLDASVQVTQLVATTHCCVNPLLYLLLDRKAFMRYLRSLFPRCNDIPYQSSGGYQQAPPREGHGRPIELYSNLHQRQDII
Tissue specificity:Expressed in macrophages, astrocytes, in glial cells. Constitutively expressed by mast cells. Detected in bronchial epithelium in OVA-induced airway inflammation. Up-regulated during dendritic cell (DC) maturation. {ECO:0000269|PubMed:12555200, ECO:0000269|PubMed:14966207, ECO:0000269|PubMed:14999816, ECO:0000269|PubMed:20606167, ECO:0000269|PubMed:9563519}.
Induction:By bacterial lipopolysaccharide in astrocytes. {ECO:0000269|PubMed:12555200}.
Developmental stage:
Protein families:G-protein coupled receptor 1 family