TMED4_MOUSE Q8R1V4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8R1V4
Recommended name：Transmembrane emp24 domain-containing protein 4
EC number：
Alternative names：(Endoplasmic reticulum stress-response protein 25) (ERS25) (p24 family protein alpha-3) (p24alpha3) (p26)
Cleaved into：
GeneID：103694
Gene names (primary )：Tmed4
Gene names (synonym )：Ers25
Gene names (ORF )：
Length：227
Mass：26022
Sequence：MAGVGVGPLQGMVRFGLLVLTVCAACARGLYFHIGETEKRCFIEEIPDETMVIGNYRTQMWDKQKEVFLPSTPGLGMHVEVKDPDGKVVLSRQYGSEGRFTFTSHTPGDHQICLHSNSTRMALFAGGKLRVHLDIQVGEHANNYPEIAAKDKLTELQLRARQLLDQVEQIQKEQDYQRYREERFRLTSESTNQRVLWWSIAQTVILILTGIWQMRHLKSFFEAKKLV
Tissue specificity：
Induction：By brefeldin A, oxidative stress and heat shock, but not by tunicamycin, hypersomotic stress or serum starvation. {ECO:0000269|PubMed:18326488}.
Developmental stage：
Protein families：EMP24/GP25L family