EST1D_MOUSE   Q8VCT4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8VCT4

Recommended name:Carboxylesterase 1D

EC number:EC 3.1.1.1

Alternative names:(Carboxylesterase 3) (Fatty acid ethyl ester synthase) (FAEE synthase) (Triacylglycerol hydrolase) (TGH)

Cleaved into:

GeneID:104158

Gene names  (primary ):Ces1d

Gene names  (synonym ):Ces1 Ces3

Gene names  (ORF ):

Length:565

Mass:61788

Sequence:MGLYPLIWLSLAACTAWGYPSSPPVVNTVKGKVLGKYVNLEGFTQPVAVFLGVPFAKPPLGSLRFAPPQPAEPWSFVKNTTSYPPMCSQDAVGGQVLSELFTNRKENIPLQFSEDCLYLNIYTPADLTKNSRLPVMVWIHGGGLVVGGASTYDGLALSAHENVVVVTIQYRLGIWGFFSTGDEHSRGNWGHLDQVAALRWVQDNIANFGGNPGSVTIFGESAGGFSVSVLVLSPLAKNLFHRAISESGVSLTAALITTDVKPIAGLVATLSGCKTTTSAVMVHCLRQKTEDELLETSLKLNLFKLDLLGNPKESYPFLPTVIDGVVLPKAPEEILAEKSFSTVPYIVGINKQEFGWIIPTLMGYPLAEGKLDQKTANSLLWKSYPTLKISENMIPVVAEKYLGGTDDLTKKKDLFQDLMADVVFGVPSVIVSRSHRDAGASTYMYEFEYRPSFVSAMRPKAVIGDHGDEIFSVFGSPFLKDGASEEETNLSKMVMKFWANFARNGNPNGGGLPHWPEYDQKEGYLKIGASTQAAQRLKDKEVSFWAELRAKESAQRPSHREHVEL

Tissue specificity:Highest expression occurs in liver with lower levels in adipose tissue, kidney, heart, intestine, lung, testis and thymus. {ECO:0000269|PubMed:11470237, ECO:0000269|PubMed:15269189}.

Induction:By di-(2-ethylhexyl) phthalate. {ECO:0000269|PubMed:15269189}.

Developmental stage:

Protein families:Type-B carboxylesterase/lipase family


   💬 WhatsApp