AIG1_MOUSE   Q9D8B1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9D8B1

Recommended name:Androgen-induced gene 1 protein

EC number:EC 3.1.-.-

Alternative names:(AIG-1) (Fatty acid esters of hydroxy fatty acids hydrolase AIG1) (FAHFA hydrolase AIG1) (EC 3.1.-.-)

Cleaved into:

GeneID:66253

Gene names  (primary ):Aig1

Gene names  (synonym ):

Gene names  (ORF ):

Length:238

Mass:27397

Sequence:MALVPCQVLRVAILLSYCSILCNYKAIEMPSHQTYGGSWKFLTFIDLVIQAVFFGICVLTDLSSLLTRGSGNQEQERQLRKLISLRDWTLAVLAFPVGVFVVAVFWTIYAYDREMIYPRLLDNFIPGWLNHGMHTTVLPFILIEMRTSHHQYPSRSSGLAAICTFSVGYILWVCWIHHVTGMWVYPFLEHIGSGARIIFFGSTTILMNFLYLLGEVLNSYIWDTQRSIEEEKEKPKLE

Tissue specificity:

Induction:By dihydrotestosterone (DHT). {ECO:0000250}.

Developmental stage:

Protein families:AIG1 family


   💬 WhatsApp