MCA3_MOUSE Q9D1M4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9D1M4
Recommended name:Eukaryotic translation elongation factor 1 epsilon-1
EC number:
Alternative names:(Elongation factor p18) (Multisynthase complex auxiliary component p18)
Cleaved into:
GeneID:66143
Gene names (primary ):Eef1e1
Gene names (synonym ):
Gene names (ORF ):
Length:174
Mass:19859
Sequence:MAAAAELRLLEKSLGLKPGNKYSAQGERQIPVLQTNNGPSLMGLSTIATHLVKQASKEHLLGSTAEEKAMVQQWLEFRVTRVDGHSSKEDTQTLLKDLNSYLEDKVYLAGHNITLADILLYYGLHRFIVDLTVQEKEKYLNVSRWFCHIQHYPDIRQHLSSIVFIKNRLYANSH
Tissue specificity:
Induction:By DNA damaging agents, such as UV, adriamycin, actinomycin D and cisplatin. {ECO:0000269|PubMed:15680327}.
Developmental stage:
Protein families: