COX7R_MOUSE Q61387
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q61387
Recommended name：Cytochrome c oxidase subunit 7A-related protein, mitochondrial
EC number：
Alternative names：(Cytochrome c oxidase subunit VIIa-related protein) (Silica-induced gene 81 protein) (SIG-81) (Supercomplex assembly factor I)
Cleaved into：
GeneID：20463
Gene names (primary )：Cox7a2l
Gene names (synonym )：Cox7rp Scaf1 Silg81
Gene names (ORF )：
Length：111
Mass：12399
Sequence：MYYKFSSFTQKLAGAWASEAYTPQGLKPVSTEAPPIIFATPTKLTSSVTAYDYSGKNKVPELQKFFQKADGFHLKRGLPDQMLYRTTMALTLGGTIYCLIALYMASQPRNK
Tissue specificity：
Induction：By estrogen and silica. {ECO:0000269|PubMed:7868905}.
Developmental stage：
Protein families：Cytochrome c oxidase VIIa family