EI24_MOUSE Q61070
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q61070
Recommended name：Etoposide-induced protein 2.4
EC number：
Alternative names：(p53-induced gene 8 protein)
Cleaved into：
GeneID：13663
Gene names (primary )：Ei24
Gene names (synonym )：Pig8
Gene names (ORF )：
Length：340
Mass：38933
Sequence：MADSVKTFLQDLGRGIKDSIWGICTISKLDARIQQKREEQRRRRASSLLAQRRPQSVERKQESEPRIVSRIFQCCAWNGGVFWFSLLLFYRVFIPVLQSVTARIIGDPSLHGDVWSWLEFFLTSIFSALWVLPLFVLSKVVNAIWFQDIADLAFEVSGRKPHPFPSVSKIIADMLFNLLLQALFLIQGMFVSLFPIHLVGQLVSLLHMSLLYSLYCFEYRWFNKGIEMHQRLSNIERNWPYYFGFGLPLAFLTAMQSSYIISGCLFSILFPLFIISANEAKTPGKAYLFQLRLFSLVVFLSNRLFHKTVYLQSALSSSSSAEKFPSPHPSPAKLKAAAGH
Tissue specificity：Found in all the examined tissues. High expression was found in liver, skeletal muscle, pancreas, kidney heart and to a lesser extent in brain, placenta and lung.
Induction：By etoposide treatment, induction requires p53. Etoposide induces DNA damage in cells by inhibiting DNA topoisomerase II, and ultimately causes apoptotic cell death. {ECO:0000269|PubMed:10594026, ECO:0000269|PubMed:8649819}.
Developmental stage：
Protein families：EI24 family