ALD2_MOUSE   P45377


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P45377

Recommended name:Aldose reductase-related protein 2

EC number:EC 1.1.1.21

Alternative names:(AR) (Aldehyde reductase) (Fibroblast growth factor-regulated protein) (Protein FR-1)

Cleaved into:

GeneID:14187

Gene names  (primary ):Akr1b8

Gene names  (synonym ):Fgfrp

Gene names  (ORF ):

Length:316

Mass:36121

Sequence:MATFVELSTKAKMPIVGLGTWKSPPNQVKEAVKAAIDAGYRHIDCAYAYCNENEVGEAIQEKIKEKAVQREDLFIVSKLWPTCFEKKLLKEAFQKTLTDLKLDYLDLYLIHWPQGLQPGKELFPKDDQGRILTSKTTFLEAWEGMEELVDQGLVKALGVSNFNHFQIERLLNKPGLKHKPVTNQVECHPYLTQEKLIQYCHSKGISVTAYSPLGSPDRPSAKPEDPSLLEDPKIKEIAAKHEKTSAQVLIRFHIQRNVVVIPKSVTPSRIQENIQVFDFQLSDEEMATILSFNRNWRACLLPETVNMEEYPYDAEY

Tissue specificity:

Induction:By FGF-1.

Developmental stage:

Protein families:Aldo/keto reductase family


   💬 WhatsApp